General Information

  • ID:  hor006610
  • Uniprot ID:  O73812
  • Protein name:  GnRH-associated peptide 1
  • Gene name:  gnrh1
  • Organism:  Morone saxatilis (Striped bass) (Perca saxatilis)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Morone (genus), Moronidae (family), Eupercaria incertae sedis, Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  ELDGLSETLGNQIVGGFPHVETPCRVLGCAVESPFPKIYRMKGFLDAVTDRENGPRTYKK
  • Length:  60
  • Propeptide:  MAPQTFALWLLLVGTLLGQGCCQHWSYGLSPGGKRELDGLSETLGNQIVGGFPHVETPCRVLGCAVESPFPKIYRMKGFLDAVTDRENGPRTYKK
  • Signal peptide:  MAPQTFALWLLLVGTLLGQGCC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O73812-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006610_AF2.pdbhor006610_ESM.pdb

Physical Information

Mass: 769114 Formula: C294H465N81O88S3
Absent amino acids: W Common amino acids: G
pI: 7.25 Basic residues: 9
Polar residues: 19 Hydrophobic residues: 17
Hydrophobicity: -42 Boman Index: -10424
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 73
Instability Index: 1642.33 Extinction Coefficient cystines: 3105
Absorbance 280nm: 52.63

Literature

  • PubMed ID:  9845669
  • Title:  Multiple GnRHs present in a teleost species are encoded by separate genes: analysis of the sbGnRH and cGnRH-II genes from the striped bass, Morone saxatilis.